PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr021393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 306aa    MW: 35114.4 Da    PI: 8.5317
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr021393.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.3e-50261551128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                  + pGfrFhPtdeelv +yL++kve+k++++ + ik++diyk++PwdLp ++ + ++kewyfF++r +ky+++ r+nr+tksg+Wkatg dk+v+s   
  Pbr021393.1  26 MLPGFRFHPTDEELVRFYLRRKVENKPIRF-DLIKHIDIYKYDPWDLPkASGSVGDKEWYFFCRRGQKYKNSIRPNRVTKSGFWKATGIDKPVYSVgd 122
                  579**************************9.99***************445555999**************************************855 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++ +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  Pbr021393.1 123 FHSCIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 155
                  4556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-5621184IPR003441NAC domain
PROSITE profilePS5100554.34526184IPR003441NAC domain
PfamPF023653.1E-2628155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEVVNQKMMS TCDSNNMIHK DQDANMLPGF RFHPTDEELV RFYLRRKVEN KPIRFDLIKH  60
IDIYKYDPWD LPKASGSVGD KEWYFFCRRG QKYKNSIRPN RVTKSGFWKA TGIDKPVYSV  120
GDFHSCIGLK KSLVYYRGSA GKGTKTDWMM HEFRLSANSS NDTSGIKNST QEAEVWTLCR  180
IMKRNNTSSG KYTSNWHKTT LNPKQSVADS SSKTCSSESD TTFGALAAKD QSERSPLVHN  240
DHIYEGNPFF RDQLSLKDEV IDPYSYISFP NSPNEYEMLT SNGNWDELRP MVDCVLNPSL  300
LFSYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-47181863170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7944476e-32EU794447.1 Malus floribunda clone M18-6Bs Vf apple scab resistance protein HcrVf2-like gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353916.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK553e-87NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM5WLG31e-165M5WLG3_PRUPE; Uncharacterized protein
STRINGVIT_12s0028g00860.t011e-102(Vitis vinifera)
STRINGPOPTR_0002s05820.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-83NAC domain containing protein 42